SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118471 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118471
Domain Number 1 Region: 87-158
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000532
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118471   Gene: ENSDARG00000069321   Transcript: ENSDART00000141739
Sequence length 220
Comment pep:known chromosome:Zv9:18:20841927:20844090:1 gene:ENSDARG00000069321 transcript:ENSDART00000141739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKVSSENIGQLLFLNDGDLSHFILALHTPEDESQVVAMFLQGKWWPVGDVLKTSNKSRCG
LLLVESLMERVVLFLLSQVIFGILERPLEDDLYFSAYSLREHGKILWQDGEAVGFYTVKK
KGSLCNGSTGQSYRLPVLDTVFVRPRWRRTGLALQMLEDFCSSQPFECILGISFPMSPSM
YGVCKKYLEVHEKERERLYEVEAPGEWPQRRNVWLNIQLR
Download sequence
Identical sequences Q1LWJ5
ENSDARP00000118471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]