SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122559 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122559
Domain Number 1 Region: 640-766
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.71e-20
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122559   Gene: ENSDARG00000041708   Transcript: ENSDART00000131811
Sequence length 782
Comment pep:known chromosome:Zv9:22:25538580:25551120:-1 gene:ENSDARG00000041708 transcript:ENSDART00000131811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGDQRGLTVQDEETMCTSASEGLEEGEVEGETLLIVESEDQASVDLSHDQSGDSLNSD
IGEDGEGSWNEDMSFYCDKCHKWIPAVQLRGEQPSYLKGDNFFKFICSDCAEDGKESFER
MRLTWQQVVMLAMYNLSLEGTGRQGYFRWKEDICAFISRHWTFLLGSRKKTSTWWSTVAG
CLSVGSPTFFRSGAQEFGEPGWWKLVQNRPPTLRPEGDKSSAASVKAKAVSKPSLDPIIT
VEGLRKRGSRNPVENAMQLKEKRSRTQEAKEIRRAQKEAAGFLDRSASSTPVKLGNRARR
PEPYLEKGEVIDFSSLSSSDRTPLTSPSPSPSPDFSAPGTPASHSATPSLLSEADLIPDV
MPPQALFHDDEELDAEGVIDPGMEYIPPPSMPLATGTIMVRKKLRPAELIKQELESEDEE
RGRDVEEDEGQDDGRRGRVLERRKGLQDKGEGCVSLPAPRHTFISLYEERMLLHKLEACP
QALAVTPQAKRLHRKLLVRQAKRERGLPLLDVDQAVSATLSLVGGVYGAQGGLARHRTSG
EEKYRTTSQDLRILDRFQSTVSVRKGFYQHTVSFWHRLMGSDACVDQTIKSPYTSRVLKP
FIRRDYESRPLKLRLLSEIRAHHHRNDPNWVAEPDAPIDYCYVRPNHIPSVNSMCQDIFW
PGIDLSECLQYPDFSVVVLYKKVVIGFGFMVPDVKYNEAYISFLLVHPEWRRAGIATFMI
YHLIQTCMGKDVTLHVSASNSAMLLYQKFGFKTEEYILDFYDKYYPVDSKECRHAFLLRL
RR
Download sequence
Identical sequences Q1LXR5
ENSDARP00000061130 ENSDARP00000122559 ENSDARP00000061130 NP_001002699.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]