SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000123032 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000123032
Domain Number 1 Region: 6-111
Classification Level Classification E-value
Superfamily Chromo domain-like 3.37e-23
Family Chromo barrel domain 0.01
Further Details:      
 
Domain Number 2 Region: 212-264
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000848
Family N-acetyl transferase, NAT 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000123032   Gene: ENSDARG00000004587   Transcript: ENSDART00000143929
Sequence length 264
Comment pep:known_by_projection chromosome:Zv9:5:25266079:25270805:1 gene:ENSDARG00000004587 transcript:ENSDART00000143929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADHSVEITEGCRLPVLRRNQENEDEWPLAEILSVKDISGRKLYYVHYVDFNKRLDEWVT
PDRLDIKKLQFPKKEAKTPMKNGLSGSRPSSPERDVKRKAESVSLATQVTAATPVPSLPA
STEASQAALYTAIRDASFNIKSREEHEPLTSLTTNGTTSIQRHLIPPQPGRKRKNCGGTD
EDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIGCIELGRHRLKPWYFSPYPQELTS
LPIIYLCEFCLKYLKSLKCLQRHL
Download sequence
Identical sequences F6NXN2
ENSDARP00000123032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]