SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000128651 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000128651
Domain Number - Region: 776-823,856-883
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0136
Family N-acetyl transferase, NAT 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000128651   Gene: ENSDARG00000077057   Transcript: ENSDART00000154395
Sequence length 931
Comment pep:novel chromosome:Zv9:24:37674400:37693089:-1 gene:ENSDARG00000077057 transcript:ENSDART00000154395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGQKRKMSSSEPEVKKTKLDRNLVESDKSQKPKRGRPPKSKVLEAQPSRQKHQIDSREE
NGKPIRRSSRLKTPLKKGARARRRKDGEKPKVSEEKSSQKMPVLKKGNKKYVSRVKREKP
IISETIKTVAAMFPVQIEHNYGRLFDMQAEEITLPKPDKIHVANKSEMQALHETQASKAE
EQKELHAEPVEKITVSVDAKVDVMSKSPPPLEALFKVIQESSLTKHSFSGKDISDMDELE
VVNTCSLQDSVQSTDVAKVFLQDSDAFLDDDVEIENCVVEIETYEDLDGDQGEVSKKQTS
ECVTCKEVNSSPSLPQESATDSSQELPKKQAMNPQARTKARLAALAEERAAAAKKPPPRH
FNLLALCEEIADDIASDAPGASDKTTNEQQQEDHESEDVSECTEVSESKDASESKEVNES
KDLSESKDASESKDVSENKEVSETETCEPEEVVSENTAPPGTPNEETADPRPEDGTPKKR
FFLSQMSVPLKTQEKKKLSRFQRLRQVELQRDKLTWTRVKKLKSDQVNQAGSQKDSEASS
VSPSPATTPAQVPTTESVPKVGSVEPKRVLPAQAPPMPNGITSPKPKPVVEYKPYTPRRK
YSPDDFELDGFEEDTAKPAAPKNVGKAEQSPSSAKVQPNPAVERKLCVPTTADSKSKSSP
QQETAQQTQLENSNSVEPEQKKEDKNSPKPESPAAQSSNEAGQKAFGAVTCNVCGMLYSP
TSAEDESQHLLFHNQFISAVRYVGWKKERILGEYPDGKIILVLPDDPKYALKKVEEIREM
VDNDLGFQQVESKVPSQTKTFLFISNDKKVAGCLIAEHIQEGYRVIEESVLEGSEGEKVM
YERQRAWCCSTVPEPALCGISRIWVFSMMRRRGIASRMIECLRNNFIYGSHLSKDEIAFS
DPTPDGKLFATHYCGTSQFLVYNFVSGKRST
Download sequence
Identical sequences X1WEK0
XP_002663315.2.45394 ENSDARP00000098819 ENSDARP00000098819 ENSDARP00000128651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]