SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000129608 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000129608
Domain Number 1 Region: 189-287
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000667
Family N-acetyl transferase, NAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000129608   Gene: ENSDARG00000097421   Transcript: ENSDART00000155653
Sequence length 436
Comment pep:putative chromosome:Zv9:25:12766429:12793799:-1 gene:ENSDARG00000097421 transcript:ENSDART00000155653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGCVVRLHGVMFNGLNTQLIIINFNQLFKTRDAPAILPTIKNEDVARAVVALLDMSLPD
VGPKDIHATVHYPGVHTIIMTRDHDDALVEYTGRPFRKKEATLSPVPRETSNSVDPTHKL
LSELYSDSEESSEEESSEEMLAEEASSRWSWGKFKEGLQELVDGARNRKKRREIRGEDGK
IPTSAVGVESLIVAAACYELKTLFTGNKVLQLSLLAVRKNYRHQGIGSYIVQLLKSQSVV
GQYDTLVAHADTDTTAFFNSNGFSDDLMLNDMFKELKDEWTNSIIMSYLPPFTTDLTMRD
PDFSLSLQEVEIELKTARSQALCAYQQQMVCVTRLLKEVKILRQQLSTVREEADCLHLRL
EHEKRKRHDVENRFMMYRLKNAQKLLDSTATDLDDQEHLNAETQEQETGQSKQPFIQTPE
GAEEHRGPRHQKYRTC
Download sequence
Identical sequences X1WH96
ENSDARP00000129608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]