SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000012078 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000012078
Domain Number 1 Region: 248-436
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.26e-29
Family Hemopexin-like domain 0.00096
Further Details:      
 
Domain Number 2 Region: 65-104
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000129
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 24-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000262
Family Somatomedin B domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000012078   Gene: ENSDARG00000010482   Transcript: ENSDART00000014785
Sequence length 486
Comment pep:known chromosome:Zv9:2:20566497:20584574:1 gene:ENSDARG00000010482 transcript:ENSDART00000014785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGLTVLWSLLALLCTVLPSSAAQGSCVGRCGEQFSRGHICNCDYNCFVHGECCKDFEDI
CTASESCRGRCGEPFRRGRQCECDSGCVLHNSCCPDYSTHCDAFSHLQAPRSSKPNKPAD
YTEECIAACLAAQQNPDVMRYGSGLNNLMTPSASPFLAGDVSQDGPYTPLSASDIPGLSS
SPSEFHLAESDAAAPLQPAGASSENPQAVPVQVSLSISGQADRPSSSSGRPSIPADIAQA
PADSSPAGPGLNLCSGVVIDGMAALFNGSIIVFRGHFFWLLNPKTRRAGPARRITEELGV
PSPIDTAFTRCNCQGKTYIIKGDSYWSFENGVLESGYPRSVSQDFGGLSGDITAALPVPA
TRKRPESVYFFKKGGKVQKLSFPPGSGPNCSGKRSKNADKPSKNGKQAEIQLSGEINIKL
KMKGFPSAVSSAVSMPNPRKSDGFDYLVFSWPKVLNVKISGDLPALTAPASHSSQQNDIT
KWLHCA
Download sequence
Identical sequences B8JMI5
ENSDARP00000012078 7955.ENSDARP00000012078 ENSDARP00000012078 NP_997918.2.45394 XP_005163421.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]