SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000024113 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000024113
Domain Number 1 Region: 67-544
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.61e-129
Family Pyridoxal-dependent decarboxylase 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000024113   Gene: ENSDARG00000026348   Transcript: ENSDART00000024354
Sequence length 544
Comment pep:known chromosome:Zv9:23:36476312:36493237:-1 gene:ENSDARG00000026348 transcript:ENSDART00000024354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNRACASTYMKAGPCIKAPRVPRHPLLIVEFHVLSTETTLNITMSSSGEYMNGHVHLEE
SDMDESDGKLFLTEAFNIIMEEILNKGRDLKEKVCEWKDPDQLRSLLDLELRDHGECHEK
LLQRVRDVAKYSVKTCHPRFFNQLFAGVDYHALTGRLITETLNTSQYTYEVAPVFVLMEE
EVISKLRSLVGWSEGDGIFCPGGSMSNMYAINVARYWAFPQVKTKGLWAAPRMAIFTSQQ
SHYSVKKGAAFLGIGTENVFIVQVDESGSMIPEDLEAKIVQAKSQDAVPFFVNATAGTTV
QGAFDPLKRIADICERNGMWMHVDAAWGGSVLFSKKHRHLVAGIERANSVTWNPHKMLLT
GLQCSVILFRDTTNLLMHCHSAKATYLFQQDKFYDTSLDTGDKSIQCGRKVDCLKLWLMW
KAIGASGLSQRVDKAFALTRYLVEEMEKRENFQLVCKGPFVNVCFWFIPPSLKGKENSPD
YQERLSKVAPVIKERMMKRGTMMVGYQPMDEHVNFFRMVVVSPQLTTKDMDFFLDEMEKL
GKDL
Download sequence
Identical sequences F1QG14
XP_009295318.1.45394 ENSDARP00000024113 ENSDARP00000024113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]