SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000024162 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000024162
Domain Number 1 Region: 107-586
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.57e-133
Family Pyridoxal-dependent decarboxylase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000024162   Gene: ENSDARG00000027419   Transcript: ENSDART00000003008
Sequence length 587
Comment pep:known chromosome:Zv9:6:3642810:3676988:1 gene:ENSDARG00000027419 transcript:ENSDART00000003008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAPSSSAGDMDPNTANLRQPATTSDAWYGVAHGCTRKLGMKICGFLQKNNSLDEKSR
MVGSFKESAKNQMSCDNNERFTRDETDFSNLFARDLLPAKNGEEPTIQFLLEVVEILTNY
VRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRF
FNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIIGWPNGDGDAL
FSPGGAISNMYSVMVARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAVLGFGKEN
VILLKTDERGRVIPADLEAKVIDAKQKGYVPLFVNATAGTTVYGAFDPINDIADICEKYN
LWLHVDGAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGILQGC
NSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDRCLELS
EYLYNKIKNREGYEMVFEGQPQHTNVCFWYIPPSLRGMPNGDERREKLHRVAPKIKAMMM
ECGTTMVGYQPQGDKVNFFRMVVSNHAVTKSDIDFLIDEIERLGQDL
Download sequence
Identical sequences Q7ZUS3
ENSDARP00000024162 NP_919400.1.45394 XP_009300378.1.45394 7955.ENSDARP00000024162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]