SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000060967 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000060967
Domain Number 1 Region: 1-344
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.88e-70
Family ADP-ribosylglycohydrolase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000060967   Gene: ENSDARG00000041589   Transcript: ENSDART00000060968
Sequence length 350
Comment pep:known chromosome:Zv9:1:74985:80899:-1 gene:ENSDARG00000041589 transcript:ENSDART00000060968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFQAAMVLGAVGDALGSRWQTCSSGSQIQQELRALGGLAALKLDAEHWPLSDGALMHM
TTAEALITDYWCLEDLYRELVRLYVEAMVSLQGRVPEPSTVEGCANLKPHNFLLAWHTPF
NEKGSGHGAATKAMCIGMRYWQPERLHTLVEVSIEAGRMTHNHPIGFLGSLCTALFASFA
VQGRPLVSWGRELLKTLPKAEEYCRKTIRHMAEYQETWFYFEAKWQFYLEERGIEDGQSK
PSFPERYDADETDRMYKRWSSEGCAGRRGHDAPMIAYDALLAAGSDWEELCRRAILHGGE
SSATGLISGCLFGLLHGLSAAPTGLHQDLDRREKLQDLGERLYRAAALEK
Download sequence
Identical sequences Q5XJB9
ENSDARP00000060967 ENSDARP00000060967 NP_001006033.1.45394 XP_021328756.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]