SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000061164 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000061164
Domain Number 1 Region: 625-1031
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.89e-122
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000526
Further Details:      
 
Domain Number 2 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.53e-87
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000195
Further Details:      
 
Domain Number 3 Region: 289-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 4.18e-76
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000197
Further Details:      
 
Domain Number 4 Region: 1165-1333
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.1e-62
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000061164   Gene: ENSDARG00000055809   Transcript: ENSDART00000061165
Sequence length 1631
Comment pep:novel chromosome:Zv9:22:25342160:25353294:-1 gene:ENSDARG00000055809 transcript:ENSDART00000061165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVVLALTLALVASQQNKLVPEFAHDKTYVYKYEALLLSGIVQEGLAKAGIQIKSKVLL
SAATENTFLLKFVDPLFYEYAGTWPKDQVFPATKLNSALAAQLQTPIKFEYANGVVGKVF
APAGVSPSVLNLYRGILNILQLNFKKTQNIYELQEAGAQGVCKTQYVISEDPKADRITVT
KSRDLSHCQERIVKDIGLAYTETCVECTKRIKSLIETANYNYIIKPSDSGALIAEATVKE
VHQFSPFNEIHGAAMMEATQSLVFVEFEKAPVVPVKADYMPRGSLQYEFATEILQTPIQL
TKISNAPAQIKEVLKHLVENNVAMVHDDAPLKFVQLVQFLRAATLKDTEAIWAQFKDKPV
YRRWLLDTLPAVATPVVLKFIKEKFLAGEFTLTEFIPTLVVALQMVPADLETIQWTASLA
LHEKIATIPALREVVMLGYGSMIAKYCVAVPTCPAELLRPIHEIATEAISKNDIPEITLA
LKVLGNAGHPSSLKPIMKLLPVLKTTASALPIRVQVDAILALRSIAKKEPKLVQPVALQL
VLERALHPELRMVACILLFETKPSVAVMSSLAGALRMETNMQVASFAYSHIKSLTRITAP
DMSSVAGAANVAIKLMNRKLDRLNFRYSRAFQLDFYHTPLMIGAAGSAYMINDAATILPR
AVIAKARAYLAGAATDVIEFGLRTEGIQEALLKSPAADESVDRITKIKRTLRALTNWKAM
PSNKPLASAYVKVFGQEMAFGRIDKTIIEQALPMVNGPKPRALLKEALKALQEGISWQRA
KPLLVAEVRRILPTSVGLPMELSMYSSVVGAATVNVQATITPPLPEQIETMTLEQLKKTD
VQFKAEARPSIAIHKFAVMGVNTAFIQAAVMARGKIRTIAPGKVAARADILKGNYKIEAL
PVELPEHIASASFETFAFARDVEDPSAERTVPLVSVLSLQNRQSQRLSSENADSEIETET
PVKAPAPFDRTLCYAVPYIEIKGCVEVHSHNAAFIRNSTLFYIIGQHSARAAVARAEGPA
VEKLEFEVQVGPRAAERLAKQINIIDDETPEGKDFLLKLREILETESKNATVSSGSSSSR
SSSSSRSSSSSSSTSNSTSSSSSSSSSSSSMSSSRWSKTLTKMEAFRKFHKDQYKTHHGD
SKSSRSTGSSLEQIQKQSRYLGNTVPPVFAIIARAVRVDRKLLGYQFVAFFDKPSSRVQF
IASSIAENDNFKFCADGVLLSKHKVTSKVTWGAECKEYAVTTKAEAGLLGEFPAFRLEWE
WERLPIIFTTYAKKLSKHIPMAALQAGFNVERAKNSEKELELTVALPSKRTLNVIVRVPE
MTMSRMDIPLPVTFPINPDGTFDVHFYEDIYFRAQNYIYDYTTAQCSMMQDTISTFNNKT
YKNEMPISCYQVLAQDCTSELKFVALLKKDEESEKTHLNVKLVDIDIDLYTLGTDAKVKI
NGLEVPISSLPYQHPSGSIQIREKADGLSLYAPSLGLHEVYFANGDWKIQVADWMKGQTC
GLCGKADGEIKQEYTTPSGYLTESSVSFAHSWVLPAESCRDASQCRMKLESVKFEKQVIL
NGQESKCYSVEPVLRCLPGCAPVRTTPVTVGYHCMSTASNLNMLAGIYEKSVDLRETTDA
HVACRCTEQCA
Download sequence
Identical sequences Q1MTC4
NP_001038378.1.45394 ENSDARP00000096034 ENSDARP00000061164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]