SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000072693 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000072693
Domain Number 1 Region: 58-225
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.32e-64
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000072693   Gene: ENSDARG00000016825   Transcript: ENSDART00000078231
Sequence length 251
Comment pep:known chromosome:Zv9:22:25283871:25290536:-1 gene:ENSDARG00000016825 transcript:ENSDART00000078231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSRMSKTATIMEPFRKFHKDRYLAAHSATKDTSSGSAAASFEQMQKKNRFLGNDIPPV
FAIIARAVRADQKLLGYQLAAYFDKPTARVQLIASSIAENDNMKICADGALLSKHKVTAK
FSWGAECKQYAVFAKAEAGVLGEYPAARLEVEWERLPKIVTTYAKKLSKCILNAAYDTGF
RFEKATNSEKEIELTAALPSQRSLNVIARIPEITMSKRDIYLPVTVPINPDGTFSINEDF
LSWIHKYIKED
Download sequence
Identical sequences ENSDARP00000072693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]