SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000083546 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000083546
Domain Number 1 Region: 486-662
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.35e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 187-291
Classification Level Classification E-value
Superfamily Histone-fold 4.57e-25
Family Nucleosome core histones 0.018
Further Details:      
 
Domain Number 3 Region: 841-951
Classification Level Classification E-value
Superfamily POZ domain 5.89e-20
Family BTB/POZ domain 0.0055
Further Details:      
 
Domain Number 4 Region: 103-179
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000647
Family Nucleosome core histones 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000083546   Gene: ENSDARG00000062000   Transcript: ENSDART00000089113
Sequence length 1032
Comment pep:novel chromosome:Zv9:25:25340056:25447212:1 gene:ENSDARG00000062000 transcript:ENSDART00000089113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTNSSNMKTLEDLTLDSGYGAGDSCKSLSLSSSKSNSQAFMNTPHRGNWWYYSGSMNS
RNNSWDTVNTVLPEDPEDIFSKCPRLPELEEFPWTEEDVGRVVRKGAGKGASFSAEAVRR
LATLMRRALIRISREAQRLSVMHCRCTKFEVQSAIRLVLSWALADHCVSATVKAISMYNM
SAGELLRKGKSARCGLVFSVGRFFRWMVDTRIAVRIHEYAAICLSACMEALVEEVGVRIL
MAEREGATPGCVLTAETLEGVINNDAELWGVLQHHEHLICGKNANGVLSLPAHFSPYTEG
RQTGLETREDAYAELELRTLEQALLATCVGSISELSDLVSRAMHHMQRLSSVRHGLSPAR
HARQQPVSWSPDALHTLYYFLRCPQMESMENPNLDPPRMALSKERPFLLLPPLMEWMRVA
IVHAEHRRSLLVDSDDVRQTARLLLPGLDCEPRLLKPECCFSSFRRLDAKAATDKFQLDL
GFRMLNCGRTDLIGQAIELLGPDGVNSMDDQGMTPLMYACSAGDEALVQMLIDAGANLDV
AVPMCSPKHPSVHADSRHWVALTFAVLHGHISVAQLLLDAGANVEGAAIRYGQENTSETP
LQLASAAGNYEMVSLLLARGADPLLRSQDSNTLTSSLYEDMNCFSHAAAHGHRNVLRKLL
SQPQKVREDVLSLEEILAEGVDGETQASGRNGHSLPPPPSPNLSLVSEDALPKLCKTRMK
ALQEASFYSAEHGYLDVTMELRSLGVPWKLHVWLESLRSAQQKSRAGVMLSLLRDFTSVK
EEDYCEELVSVGLPLMFNILKNSKNEAIIQQLGIIFSHCYGTAPLPPIQEKKAALAAQLD
PHFLNNQEMSDVTFLVEGKPFYAHGVLLLTASDRFKTLLAQNGSDSTQTRKDIEISNIKY
NIFQMMMSYLYCGGTESLKMGVSELLELLSAASLFQLGVLQRHCEILCAQNIDLDNAVNI
YHTAKANGAVELSTYCEGYFLQNMAVLLEREAFRVMILGSGARSGSGKDSLLEALEATLV
RRLRSLLVTSRV
Download sequence
Identical sequences F1QLH2
ENSDARP00000083546 XP_001923186.1.45394 XP_009296329.1.45394 XP_021329553.1.45394 XP_021329554.1.45394 ENSDARP00000083546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]