SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000096034 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000096034
Domain Number 1 Region: 368-536
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.96e-62
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00022
Further Details:      
 
Domain Number 2 Region: 35-314
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.83e-61
Family Lipovitellin-phosvitin complex, superhelical domain 0.00000118
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000096034
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0471
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000096034   Gene: ENSDARG00000055809   Transcript: ENSDART00000105263
Sequence length 834
Comment pep:known chromosome:Zv9:22:25342161:25353294:-1 gene:ENSDARG00000055809 transcript:ENSDART00000105263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEATQSLVFVEFEKAPVVPVKADYMPRGSLQYEFATEILQTPIQLTKISNAPAQIKEVL
KHLVENNVAMVHDDAPLKFVQLVQFLRAATLKDTEAIWAQFKDKPVYRRWLLDTLPAVAT
PVVLKFIKEKFLAGEFTLTEFIPTLVVALQMVPADLETIQWTASLALHEKIATIPALREV
VMLGYGSMIAKYCVAVPTCPAELLRPIHEIATEAISKNDIPEITLALKVLGNAGHPSSLK
PIMKLLPVLKTTASALPIRVQVDAILALRSIAKKEPKLVQPVALQLVLERALHPELRMVA
CILLFETKPSVAVMSSSRWSKTLTKMEAFRKFHKDQYKTHHGDSKSSRSTGSSLEQIQKQ
SRYLGNTVPPVFAIIARAVRVDRKLLGYQFVAFFDKPSSRVQFIASSIAENDNFKFCADG
VLLSKHKVTSKVTWGAECKEYAVTTKAEAGLLGEFPAFRLEWEWERLPIIFTTYAKKLSK
HIPMAALQAGFNVERAKNSEKELELTVALPSKRTLNVIVRVPEMTMSRMDIPLPVTFPIN
PDGTFDVHFYEDIYFRAQNYIYDYTTAQCSMMQDTISTFNNKTYKNEMPISCYQVLAQDC
TSELKFVALLKKDEESEKTHLNVKLVDIDIDLYTLGTDAKVKINGLEVPISSLPYQHPSG
SIQIREKADGLSLYAPSLGLHEVYFANGDWKIQVADWMKGQTCGLCGKADGEIKQEYTTP
SGYLTESSVSFAHSWVLPAESCRDASQCRMKLESVKFEKQVILNGQESKCYSVEPVLRCL
PGCAPVRTTPVTVGYHCMSTASNLNMLAGIYEKSVDLRETTDAHVACRCTEQCA
Download sequence
Identical sequences F1R876
ENSDARP00000072790 ENSDARP00000096034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]