SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098071 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098071
Domain Number 1 Region: 110-510
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.34e-120
Family Pyridoxal-dependent decarboxylase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098071   Gene: ENSDARG00000061375   Transcript: ENSDART00000111567
Sequence length 572
Comment pep:known chromosome:Zv9:13:25951784:25974800:-1 gene:ENSDARG00000061375 transcript:ENSDART00000111567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYWSALEVYKETALLYIEEAQSYVNSQCAGLEPWQIIAATLLSTLGVVWLKDFLFQQES
LTSRVKKQFFRIIRKIPFIGASIQNQLNKALDDMSMSLCTLKEGMSYTKLLPAQGLTHKQ
LLDKIREYETLSEVNWAKGKVSGAVYWGDEKLTDLLVKVYGEFAWTNPLHPDIFPGVRKM
EAEVVRMTCALFNGGPDSCGTVTSGGTESILMACKAYRDMAHERGIKHPEIIAPISVHAA
FDKAAHYFGMKLIHVPLDNKTMKVDVKAMRRAITKNTAMLVCSAPQFPHGIMDPVEEVAK
LAVKYNIPFHVDACLGGFLIVFMEKAGFKLAPFDFRVKGVTSISADTHKYGYAPKGSSVV
LYSNRKFRHYQYFVAPDWQGGIYASPSMAGSRPGGIIAACWATMMHMGEKGYVEATRKVV
ETTRKIKTGIRKIDGVFVFGDPEVSVVALGSDDFDIFRLSNALTSKGWNLNTLQFPSSIH
ICVTMLHTQSGVAEQFISDVKKEVAIIMKNPKEKTTGMGAIYGMAQSIPDRSMVTEVSQG
FLDCLYSTEVPKMQNKHHKNHKNHINGNSKVH
Download sequence
Identical sequences A4QNU7
NP_001082938.1.45394 7955.ENSDARP00000098071 ENSDARP00000098071 ENSDARP00000098071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]