SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100701 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100701
Domain Number 1 Region: 525-616
Classification Level Classification E-value
Superfamily TAFH domain-like 5.1e-34
Family TAFH domain-like 0.000045
Further Details:      
 
Domain Number 2 Region: 761-808
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000398
Family TBP-associated factors, TAFs 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100701   Gene: ENSDARG00000075805   Transcript: ENSDART00000109605
Sequence length 976
Comment pep:novel chromosome:Zv9:25:20763702:20847040:1 gene:ENSDARG00000075805 transcript:ENSDART00000109605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSLRFPQCLSSKTTHAPYAFLKRLSKMAGVPDPLEDMLYSEVDEKAVSDLVGSLESQLG
GQNKTVGPQGDARRASNALNPHLGKLLPAQVGTTLEQQQRQRQAERNQEGNSQENGPDRI
PASNCVPATANLPANTSANLVPAANLAQYHSSNPSTCSSDAAAPTDSHPNTNHIACAVRT
VPARTQPVNGSSSTLNSSVIASAPASVNGIDVGSGGGSGNKSNMSAPTSTNTAFVPAQPN
STLPHANVSLDSQANPTIALHRPPNTITSVVHNGGDPKVSGLPVQGAALVPTPVAFTNTE
PKSDPQNQIKAIVPNQLPGAPVGLHPSTPTQIIVSSSPVVTSLPVASTPSALPKPTATAL
VGQPTTLLRPATPTQGTPTATPQQRPGAPTTQLIVRPPQQTTIQLPPGFTIPPGMVLVRT
EAGQLALVPQQVLAQAKAQNQNKGTLSPRPATPTAGAPFRVTTPVAQQKTAVVTITSAQK
PTTTVITAGARVQPAPQTVLKPSVTPQSPVTPPVTVSANRAPVLSQEMQENVKKCKNFLA
TLIKLASHNSPSPETSRNVKALVQDLLDAKIEPEEFTNRLQTELKSSPQPYLIPFLKKSL
PALRLTLLNSQQSLTQLSQTSATAAAPLPVNTIKAPAPSTLSTTIRPTTALTPASALAVK
RPGVQTTPTRMPVVITQTVRAQGAIGTPLQVRSPMGVAIHASANQKQKLNDPGGGTFRDD
DDINDVASMAGVNLNEENARILATGSELVGTQIRSCKDEAFLPASLLHKRLLETAKKFGV
TEVSMETVTLISHATQSRLRSMLEKVSAVAQHRADSCKDEDLYEQTSDVRTQLKFFEQLE
KIEKQRKDDEERELLMKAAKSRSRQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAA
IGPRKKRKLDSPGASAGAELPAGSSGSATGSTSSSSSSVRQTRQRITRVNLRDLIFCLEQ
ERTTARSTLLYKALLK
Download sequence
Identical sequences E7FFQ2
XP_005163125.1.45394 ENSDARP00000100701 ENSDARP00000100701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]