SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101309 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101309
Domain Number 1 Region: 402-806
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.71e-124
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000112
Further Details:      
 
Domain Number 2 Region: 66-400
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 2.35e-83
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000195
Further Details:      
 
Domain Number 3 Region: 942-1109
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.12e-62
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0002
Further Details:      
 
Domain Number 4 Region: 2-66
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000000000302
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101309   Gene: ENSDARG00000078429   Transcript: ENSDART00000109411
Sequence length 1135
Comment pep:known chromosome:Zv9:22:25256488:25275841:-1 gene:ENSDARG00000078429 transcript:ENSDART00000109411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPADNGALIAEATVEEVYQFSPFNEIHGAAMMEAKQTLAFVEIEKTPVVPFKADYMHRG
SLQYEFATEILQTPIQLMKISDAPAQIVEVLKHLVANNKDMVHDDAPLKFVQLVQLLRVA
TLEKIEAIWSQFKDKPVYRRWLLDALPAVGTPVIIKFIKEKFLAGEFTTPEFIQTLVIAL
QRVSADLETIQMTASLAMHEKFSTVPALREVAMLGYGSLIARHCIAVPTCPAELLRPIHE
IATEAVSKNDIPEITLALKVMGNAGHPSSLKPIMKLLPGLRTAANALPVRVQVDAILALR
NIAKKEPKLVQPIALQLVLDRALHPEVRMVACIVLFEAEPSVALISSLAGALRTEPNMHV
ASFAYSHIKSLTRITAPDMAYVAGAANVAIKLMNCKLDRLNYRYSRAFKMDYYYTPLMIG
AAGSAYMINDAATILPRAVVAKARAYLAGAAADVVEFGVRTGGIHEALLKSPAADESVDR
ITKIKRTLRALTNWKALPTDKPLASAYVKVFGQEVAYVNFDKTIIEEAIPMVTGPKPRAL
LKEALKALQEGIAFQYAKPLLAAEVRRILPTAVGVPMEFSWYTAAVAAASVNVQATVTPA
LPEKLESMTYEQLKKTDVQFQAEARPSVALQTFAVMGVNTAFIQAAVMARGKIRTIAPGK
VAARADILKGNYKVEALPVDLPEHIASASFETLAVVRNIEDHSAERSVPFVPELSLQNSQ
ASYAGDLSSEVSPDASVRAPAPFDRTLCYAVPYIEIKGCVEVHSHNAAFIRNSTLFYIIG
HHTARAAVSRAEGPAVERLEFEVQVGPRAAERLLKQINIIDDDTPEGQAFLLKLREILDT
EAKNAPVSSESSSSSSRNSRSTSSSSTSTSSSGSSSSSSSSSSSMSSSRMSKTATIMEPF
RKFHKDRYLAPHSATKDTSSGSAAASFEQMQKKNRFLGNDIPPVFAIIARAVRADQKLLG
YQLAAYFDKPTARVQLIASSIAENDNMKICADGALLSKHKVTAKFSWGAECKQYAVFAKA
EAGVLGEYPAARLEVEWERLPKIASTYAKKVSKYILNAAYDTGFRFERATNSEKEIELTA
ALPSQKSLNVIARIPEITMSRRDIYLPVTVPINPDGTFTIDKDFLSWIHKYINED
Download sequence
Identical sequences ENSDARP00000101309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]