SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102472 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102472
Domain Number 1 Region: 625-1029
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.37e-124
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000849
Further Details:      
 
Domain Number 2 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 9.81e-93
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000098
Further Details:      
 
Domain Number 3 Region: 289-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.27e-83
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000195
Further Details:      
 
Domain Number 4 Region: 1167-1334
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.51e-62
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102472   Gene: ENSDARG00000078429   Transcript: ENSDART00000114647
Sequence length 1362
Comment pep:known chromosome:Zv9:22:25203748:25330501:-1 gene:ENSDARG00000078429 transcript:ENSDART00000114647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVVLALTVALVASQQMNLVPEFAHDKTYKYKYEALLLGGLPQEGLARAGIKVSSKVLL
SAVTENTYLMKLMDPLLYEYAGTWPKDSFVPATKLTSALAAQLQIPIKFEYANGVVGKVF
APAGVSPTVMNLHRGILNILQLNLKKTQNIYELQEAGAQGVCRTHYVINEDPKTNHIIVT
KSKDLSHCQERIMKDVGLAYTERCAECTKRVKSLIETATYNYIMKPADNGALIAEATVEE
VYQFSPFNEIHGAAMMEAKQTLAFVEIEKTPVVPFKADYMHRGSLQYEFATEILQTPIQL
MKISDAPAQIVEVLKHLVANNKDMVHDDAPLKFVQLVQLLRVATLEKIEAIWSQFKDKPV
YRRWLLDALPAVGTPVIIKFIKEKFLAGEFTTPEFIQTLVIALQRVSADLETIQMTASLA
MHEKFSTVPALREVAMLGYGSLIARHCIAVPTCPAELLRPIHEIATEAVSKNDIPEITLA
LKVMGNAGHPSSLKPIMKLLPGLRTAANALPVRVQVDAILALRNIAKKEPKLVQPIALQL
VLDRALHPEVRMVACIVLFEAEPSVALISSLAGALRTEPNMHVASFAYSHIKSLTRITAP
DMAYVAGAANVAIKLMNCKLDRLNYRYSRAFKMDYYYTPLMIGAAGSAYMINDAATILPR
AVVAKARAYLAGAAADVVEFGVRTGGIHEALLKSPAADESVDRITKIKRTLRALTNWKAL
PTDKPLASAYVKVFGQEVAYVNFDKTIIEEAIPMVTGPKPRALLKEALKALQEGIAFQYA
KPLLAAEVRRILPTAVGVPMEFSWYTAAVAAASVNVQATVTPALPEKLESMTYEQLKKTD
VQFQAEARPSVALQTFAVMGVNTAFIQAAVMARGKIRTIAPGKVAARADILKGNYKVEAL
PVDLPEHIASASFETLAVVRNIEDHSAERSVPFVPELSLQNSQASYAGDLSSEMSSVASV
RAPAPFDRTLCYAVPYIEIKGCVEVHSHNAAFIRNSTLFYIIGHHSVRAAVARAEGPAVE
RLEFEVQVGPRAAERLVKQINIIDDDTPEGQAFLLKLREILDTEAKNAPVSSESSSSRNS
RSSSSRSTSTSTSSSSSSSSSSSSSSSSSMSSSRMSKTATIIEPFRKFHKDRYLAHHSAT
KDTSSGSAAASFEQMQKQNRFLGNDIPPVFAIIARAVRADQKLLGYQLAAYFDKPTARVQ
LIVSSIAENDNMKICADGALLSKHKVTGKFSWGAECKQYAVFAKAEAGVLGEFPAARLEV
EWERLPIIVTTYAKKLGKHILTAAYDTGFRFERATNSEKEIELTAALPSQRSLNIIARIP
EITMSKRDIYLPVAVPINPDGTFSIETYEDFLAWIQKYIKEE
Download sequence
Identical sequences ENSDARP00000102472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]