SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103064 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103064
Domain Number 1 Region: 348-440
Classification Level Classification E-value
Superfamily TAFH domain-like 2.62e-34
Family TAFH domain-like 0.00000463
Further Details:      
 
Domain Number 2 Region: 608-656
Classification Level Classification E-value
Superfamily Histone-fold 2.55e-16
Family TBP-associated factors, TAFs 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103064   Gene: ENSDARG00000068192   Transcript: ENSDART00000110140
Sequence length 733
Comment pep:known_by_projection chromosome:Zv9:11:21791593:21820579:-1 gene:ENSDARG00000068192 transcript:ENSDART00000110140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTTLIGTSTVQTLNGGNAMDPHTESGTPVSSGPSSSSSDDASTSVPVVNNGPGVAKGLG
NVTVAPSPNTVIQSSFGTPPAAASSAGPLVTVVRPSMQTAGAGLTINGSNNNTTISVANV
ATPGITTTSTTTTSSTTTTTPLLLNQTSAPVTASKSESPKTIIQPAGSMTVGPAVAKGAV
LQGVARTAAPATVAAASASSSPTIRASAPQVLAPRLPQSSPGQNIQNIQLPPGMVLVRSD
SGQLLMIPQQMLAQLQAQTQSARPAAPASTTPAQITPAQAPGTPLMARQVTPTTIIKQGS
HTASSTATTTLQRPPVQQASSVGPVLSVQAGAAQRTVTAATGTTVSSATETMENVKKCRN
FLSTLIKLATSGKQSSETVANVKELVKNLLEGKIEAEEFTSRLYKELNSSPQPYLVPFLK
RSLPALRQLTPDSTAFIQQSQALHSPTVVLTSPNTAGGTTAAPRTLTQPALSNSSQTASL
VLQSPQQGAIVKPPQVTLTTTPMVTLRGQPHSHIVVGQPQLQLKQIQTVPLKQGVMASTK
LVHSSVNLVAAQKNKPKDGAGGTFRDDDDINDVASMAGVNLSEESARILATNSELVGAVT
RSCKDEAFLSASMLQHKILEIGQRFGVTDLGPEVVNIVSHATQQRLQNLLEKVSLIAQQK
NMTYKEDSRYEQVEDVRAQLKFFEQLDQLEKQKKEEQEREILMKAAKVSKPPPAILALSH
TDLIPTLARGSDH
Download sequence
Identical sequences ENSDARP00000103064 ENSDARP00000103064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]