SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103502 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103502
Domain Number 1 Region: 63-543
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.19e-132
Family Pyridoxal-dependent decarboxylase 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103502   Gene: ENSDARG00000055370   Transcript: ENSDART00000109561
Sequence length 546
Comment pep:novel chromosome:Zv9:2:28046304:28068397:-1 gene:ENSDARG00000055370 transcript:ENSDART00000109561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRSPESIMDFTQADRRHLDKSKQDTSSLENTDDGLKYDSGRVTHDFSCIHSKDLLPAED
GEEATKHFLQELVNILLAYISKSLKRSTKVLDFHYPHQLNEGLEGFSLELPDQPDNLEQL
LVDCRDTLKYGVKTGHPRFFNQLSTGLDIVGLAGEWLTSTANTNMFTYEISPVFILMEEV
VLRKMHTIIGWPEEDGDGIFCPGGSMSNLYSVLLARFHLFPAVKTHGMCAIPRLAMFTSA
HSHYSIKKSAAVLGIGTENVIVVRCDERGKMISSELNSSIEEAKSKGLVPFYVNATAGTT
VYGAFDPLHKIADICEHHGLWMHVDAAWGGGLLLSNKHRVKLHGIERAHSVTWNPHKMMG
VPLQCSTILVKRKGLLQQCNQLCAEYLFQPDKHYEVSYDTGDKSIQCGRHVDIFKLWLMW
KAKGSEGFESQVNHCLENAEYLYYKLKRRTDFQLVFKGKPEHSNVCFWYLPKRVQNIPLG
PEREKELHMVAPKIKTKMMEEGFTMIGYQPLEDKVNFFRCVFSNPATQREDVDFLLDEIV
RLGCEL
Download sequence
Identical sequences B0V1P2
ENSDARP00000103502 ENSDARP00000103502 NP_001083039.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]