SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106346 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106346
Domain Number 1 Region: 394-791
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.06e-81
Family GABA-aminotransferase-like 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106346   Gene: ENSDARG00000052124   Transcript: ENSDART00000128591
Sequence length 916
Comment pep:novel chromosome:Zv9:25:9149694:9177908:1 gene:ENSDARG00000052124 transcript:ENSDART00000128591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLIHVYGKKYERGSNWSEPEVLELLQIWSDVPVQTELVTCLRNQHVFNRIASTLRQKGI
NRTGDQCREKIKKLKLEYKQKTLRSARYYELMERAQSNRSAATSGSTLPLWGGATGNQVI
GQQGSEAPGHPSRTVEMLEIKTEVMSSDDEAAQPEMLYEFGPVDEDEEAGGEHKQAVQNA
EESAEMDGEQGNAHVICSPSDCSDQNMTGSSGAGVSPATAPMAMRDGGGTHCDQEGVSGS
FHQRKRRRVVRPNDGVLSSALAGYLSWQQTAEERFLALEEARMRQEARAEERREQQEERR
AKQERDHEFRLMSMLTRVLNSTRGTEDQSASTSRETVPKPSSLQTLLPHLLPNSAKAVPS
MLLGDQTPQYNPYLSRRGNSMRIHQGILQEGYNQYHANKHDEKSNPHGIINLGTSENKLC
FDLLQKRLTRPDMLNIEPAFLQYPDWKGHSFLREEVAKFLSDYCCSPKPLKPENVVVMNG
CGSLFSALAATLCDPEDAILIPSPFYGVITEDVDLYSSVKLHHVPLYSQPRGSDVRPFQL
TVDKLENSLKEAKTEGLNVKALILLNPHNPLGEVYSSEEMTGFLQFAKMHQLHVIVDEIY
MLSVFGEKHTFRSVLSLDGLPDPQRTHVMWGVSKDFAMAGMRVGTIYSENKDLVQALDQL
GCFHGVPGPTQYQMAQLLRDRDWLNSEFLPENKRRLKEAHKYLTEELKKLDIPFLHRGAG
FFIWADLSKFLKEKTFAEELCVWRCFLKHRLLLSCGQAFSCASPGWFRIIFTDQQHKLQL
GVQRMKTALEELQGSLVPEDQRTTAVELKTSAGRATRTDTKTTDECKETTLKSSSAQTKL
ENTRIKTEPLSLADENFAILNGQSNMHSESLDTLIGALQKQIHSSDWLEKHRPELAAGVD
PTQLEVFTDLLEKARK
Download sequence
Identical sequences F1QMK2
ENSDARP00000106346 ENSDARP00000106346 XP_005163034.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]