SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108730 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108730
Domain Number 1 Region: 22-168
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.66e-28
Family Transferrin 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108730   Gene: ENSDARG00000016771   Transcript: ENSDART00000127207
Sequence length 169
Comment pep:known chromosome:Zv9:2:16590032:16592930:-1 gene:ENSDARG00000016771 transcript:ENSDART00000127207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLLISLLGCLVVALPSASAQKKVKWCVTTQNEQSKCRHLATKAADIECHLQPTVIDCM
RSIAAGGTDIVTVDGANVFTGGLNNYLLRPIIAEKKKECCYAVAAVKAGSGFNINELKGK
SSCHSCYQSVALSEGSPFSSNLLLPKSLCSFVFSSCVRILLEQLCPWCI
Download sequence
Identical sequences E7F6H5
ENSDARP00000108730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]