SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109791 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109791
Domain Number 1 Region: 9-140
Classification Level Classification E-value
Superfamily Histone-fold 1.06e-40
Family TBP-associated factors, TAFs 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109791   Gene: ENSDARG00000059752   Transcript: ENSDART00000127108
Sequence length 176
Comment pep:known chromosome:Zv9:6:20200119:20210111:-1 gene:ENSDARG00000059752 transcript:ENSDART00000127108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLVSSEANEICNK
SEKKTISPEHVINALESLGFGSYIAEVKDVLQECKTVALKRRKASSRLENLGIPEEELLR
QQQELFAKARQQQAELAQQEWLQMQQAAQQAQLAAASASSTQQAGSSQDEDEEDDM
Download sequence
Identical sequences Q08BR1
ENSDARP00000077836 ENSDARP00000109791 ENSDARP00000110539 ENSDARP00000126013 ENSDARP00000077836 NP_001070782.1.45394 XP_009300647.1.45394 7955.ENSDARP00000077836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]