SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110348 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110348
Domain Number 1 Region: 107-612
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.95e-127
Family Pyridoxal-dependent decarboxylase 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110348   Gene: ENSDARG00000027419   Transcript: ENSDART00000122348
Sequence length 613
Comment pep:known chromosome:Zv9:6:3642627:3676989:1 gene:ENSDARG00000027419 transcript:ENSDART00000122348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAPSSSAGDMDPNTANLRQPATTSDAWYGVAHGCTRKLGMKICGFLQKNNSLDEKSR
MVGSFKESAKNQMSCDNNERFTRDETDFSNLFARDLLPAKNGEEPTIQFLLEVVEILTNY
VRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRF
FNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIIGWPNGDGDAL
FSPGGAISNMYSVMVARYKYFPEVKTKGMSAAPRLVLFTSEHRTALLMRESGSVLDHLID
GRPFLFSQSHYSIKKAGAVLGFGKENVILLKTDERGRVIPADLEAKVIDAKQKGYVPLFV
NATAGTTVYGAFDPINDIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLSGIERANSVTW
NPHKMMGVPLQCSAILVREKGILQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDI
FKFWLMWKAKGTIGFEQHIDRCLELSEYLYNKIKNREGYEMVFEGQPQHTNVCFWYIPPS
LRGMPNGDERREKLHRVAPKIKAMMMECGTTMVGYQPQGDKVNFFRMVVSNHAVTKSDID
FLIDEIERLGQDL
Download sequence
Identical sequences F1Q5U5
ENSDARP00000110348 ENSDARP00000110348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]