SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110759 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110759
Domain Number 1 Region: 4-126
Classification Level Classification E-value
Superfamily Histone-fold 4.49e-48
Family Nucleosome core histones 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110759   Gene: ENSDARG00000086552   Transcript: ENSDART00000127042
Sequence length 143
Comment pep:known_by_projection chromosome:Zv9:7:7228572:7229349:1 gene:ENSDARG00000086552 transcript:ENSDART00000127042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKAAKNRPVHSLKRSPTQSNDE
Download sequence
Identical sequences ENSDARP00000110759 ENSDARP00000110759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]