SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112635 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112635
Domain Number 1 Region: 477-607,639-707
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.26e-38
Family Hemopexin-like domain 0.00071
Further Details:      
 
Domain Number 2 Region: 62-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000837
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 22-60
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000102
Family Somatomedin B domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112635   Gene: ENSDARG00000028163   Transcript: ENSDART00000143901
Sequence length 711
Comment pep:novel chromosome:Zv9:20:34054428:34064246:1 gene:ENSDARG00000028163 transcript:ENSDART00000143901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYLSVLLLFVWVSTSSSNPRSCGGRCGEGYYRGSFCQCDYDCLGLNECCADFQDLCTS
KDSCKGRCGEPFNRGNPCHCDIDCVSYNQCCPDYESMCLIEESSNEEMTNLEGTGDEFTV
PEYETEPTPSEGRDVPAEILPEGPYTGSDIEEKQKENSTFHPENETSSPAPSTPTADVSS
IFPADENHIDFTTQQPSEELTASSTLQPQENSSIALTEGPTSVTPVDDSPEEDPKKQTIT
VDPTSPVPAEDPTSPGLAEDPTSPGPAEDPISPVPAEDPTSPGPAEDPISPVPAEDPTSP
VPAEDPISPVPAEDPTSPVPAEDPTSTVAPEDPNNQTPAENPTSPAATADPTDQNPAEDP
RNPAPAEDSRKPAPTEDPTSMAPTEGSTSAAPTENLTTAPTEGATPVPRKTPAPMKPTKK
PTQPSKENIDKSEVKESPKDPVVISPIRVTEKPLKPSSDLNGRTDILDYQSDDYDSNLCS
GRPVSGLTTLRNGTIVVFRGHYFWTLDKQRNPDPPQLITQVWGIPSPIDTVYTRCNCQGK
TYFFKGKNYWRFENGAMDPGFPKPISEGFGQIGHITAALSIPEYRSRKESVIFFKRGGMA
QKYTYQVTPNCGRRPKIPVITVRMRTRRQTAAALGQVINISRTWRGFPTMVTSSVSVPSR
VKEGYKYYVFSQRNYYSMKMERDKPVILKPVTGPKENPATSFFKCKDTQKI
Download sequence
Identical sequences F1REF9
NP_001315259.1.45394 ENSDARP00000112635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]