SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113984 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113984
Domain Number 1 Region: 408-810
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.22e-138
Family Ankyrin repeat 0.0000000000103
Further Details:      
 
Domain Number 2 Region: 171-426
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.2e-78
Family Ankyrin repeat 0.00000251
Further Details:      
 
Domain Number 3 Region: 19-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.33e-63
Family Ankyrin repeat 0.0000214
Further Details:      
 
Domain Number 4 Region: 1420-1504
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-22
Family DEATH domain, DD 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113984   Gene: ENSDARG00000074777   Transcript: ENSDART00000144361
Sequence length 1703
Comment pep:known_by_projection chromosome:Zv9:21:19855250:19917656:-1 gene:ENSDARG00000074777 transcript:ENSDART00000144361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFMSFSSLSSPQADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGH
VKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYM
AAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPAL
HIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK
NGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAP
LQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVL
LDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHL
NIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCA
ARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGF
TPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHS
TARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK
QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMV
KFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRL
GYISVIDVLKLVTEESVSMITTEKHRMSFPETVDEILDVSEDEGDELLGMDGARYLKLDD
LKDQDDDFLSPKKTLRDFESGMGTTPYSPAIPRIPCVSPETVMLDQHTPVPLPKEYDEDS
LIPSSPATETSDNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTR
ITCRLVKPQKLTTPPPLVEGEGLASRIISLGPSSMQFLGPVIVEIPHFASLSRGDRELVV
LRSENGSVWKEHRNRYGDDVLETILNGMDEDLESQEELEKKRIRRIISTDFPLYFAVVSR
VRQESDLIGPEGGQLASKLVPQVQAIFPDTAVTKRVRLGLQAQPIPDELLTRQLGNQATF
SPVVTVEPRRRKFHRPIGLRIPLPPSWRESPRDAGEGDTTSLRLLCSVIGGTAPAQWEDI
TGTTKLMYSHNCANFTTNVSARFWLADCPRTAEAVTFANLLYRELMSVPYMAKFVVFAKM
NDAREGRLRCYCMTDDKIDKTLELHENFSEVARSRDIEVMEGMPLHLECSGNLVPVRKAT
QQPRSFSFQAFRDNRLPVSVKVCSSVRDANKEASGFLSFLRKSTKYEDTQHVLCNLNITM
PPCVKGVGSDDRRRTLTPLALRERYSALSEPGLAAVNAMERTELKITVIAEQLGLSWTEL
ARELQFGVDDINRIRVENPNSLLDQSSALLNLWVGREGKKAKMESLYGALKNIDRSDIVK
CLEAQAPPVLPETLEEGACRLVDRDSTLLSPSVVNGQQLYAQLCERTGLTRSLEHNGDRL
GSGAFQPYSQEKDSLHSWSQPKPRQTMETMMSSSPDHNQSRVAQEALLTPVCDTGHSEVL
RGRLLGTQPFDKGLGFSHQEGELRAWDQERRKAQKDDPVDLSSDLLHEEQFTDEHGNVVT
KLGVDVKKDVQTVKRSSLRRVKH
Download sequence
Identical sequences F1QV17
ENSDARP00000113984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]