SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113988 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113988
Domain Number 1 Region: 630-1034
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 8.24e-127
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000903
Further Details:      
 
Domain Number 2 Region: 29-294
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.29e-92
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000103
Further Details:      
 
Domain Number 3 Region: 294-628
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.18e-83
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000192
Further Details:      
 
Domain Number 4 Region: 1175-1342
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.33e-62
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113988   Gene: ENSDARG00000016825   Transcript: ENSDART00000143443
Sequence length 1368
Comment pep:known chromosome:Zv9:22:25283866:25290536:-1 gene:ENSDARG00000016825 transcript:ENSDART00000143443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKPPAMRAVVLALTVALVASQQFNLVPEFAHDKTYVYKYEALLLGGLPQEGLARAGIKVS
SKVRLSAMTENTYLMKLMDPLLYEYAGTWPKDSFVPATKLTSALAAQLQIPIKFEYANGV
VGKVFAPAGVSPTVMNLHRGILNILQLNLKKTQNIYELQEAGAQGVCRTHYVINEDPKTN
HIIVTKSKDLSHCQERIMKDVGLAYTERCAECTKRVKSLIETATYNYIMKPADNGALIAE
ATVEEVYQFSPFNEIHGAAMMEAKQTLAFVEIEKTPVVPIKADYMPRGSLQYEFASEILQ
TPIQLMKIKDAPAQIVEVLKHLVENNKDMVHDDAPFKFVQLVQLLRVVTLDKIEAIWSQF
KDKPVYRRWLLDALPAVGTPVIIKFIKEKFLAGEFTTPEFIQTLVIALQMVTADLETIQM
TASLAMHEKFVSIPALREVVMLGYGSLIAKHCVAVPTCPAELLRPIHETATEAISKNDIP
EITLALKVMGNAGHPSSLKPIMKLLPGLRTAANALPVRVQVDAILALRNIAKKEPKLVQP
VALQLVLDRALHPEVRMVACIVLFETEPSVALISSLAGALRTEPNMHVASFAYSHIKSLT
RITAPDMAYVAGAANVAIKLMNCKLDRLNYRYSRAFQMDYYYTPLMIGAAGSAYMINDAA
TILPRAVVAKARTYLAGAAADVVEFGVRTGGINEALLKSPAADESVDRITKIKRTLKALT
NWKALPTDKPLASAYVKVFGQEVAYVNFDKTIIEEAIPMVTGPKPRALLKEALKALQEGV
AFQYAKPLLAAEVRRILPTAVGVPMEFSWYTAAVAAASVNVQATITPALPEKLESMTYEQ
LKKTDVQFQAEARPSVALQTFAVMGVNTAFIQAAVMARGKIRTIAPGKVAARADILKGNY
KVEALPVDLPEHIASASFETHAVVRNIEDHSAERSVPLVPQLSLQNSQTSNANDWSSEMS
PDVSVKAPAPFDRTLCYAVPYIEIKGCVEVHSHNAAFIRNSTLFYIIGQHSAHVAVARAE
GPAVERLEFEVQVGPRAAERLVKQINIIDDDTPEGQAFLLKLREILDTEAKNAPVSSESS
SSSRNSRSISSSSSNSNSNSSSSSSSSSSSSSSSSSSMSSSRMSKTATIMEPFRKFHKDR
YLAAHSATKDTSSGSAAASFEQMQKKNRFLGNDIPPVFAIIARAVRADQKLLGYQLAAYF
DKPTARVQLIASSIAENDNMKICADGALLSKHKVTAKFSWGAECKQYAVFAKAEAGVLGE
YPAARLEVEWERLPKIVTTYAKKLSKCILNAAYDTGFRFEKATNSEKEIELTAALPSQRS
LNVIARIPEITMSKRDIYLPVTVPINPDGTFSINEDFLSWIHKYIKED
Download sequence
Identical sequences F1QV15
ENSDARP00000113988 ENSDARP00000113988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]