SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114558 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114558
Domain Number 1 Region: 625-1029
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.1e-125
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000101
Further Details:      
 
Domain Number 2 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.14e-92
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000115
Further Details:      
 
Domain Number 3 Region: 289-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 6.93e-81
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000229
Further Details:      
 
Domain Number 4 Region: 1148-1315
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 6.67e-60
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114558   Gene: ENSDARG00000092419   Transcript: ENSDART00000138378
Sequence length 1343
Comment pep:novel chromosome:Zv9:22:25323697:25330519:-1 gene:ENSDARG00000092419 transcript:ENSDART00000138378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVVLALTVALVASQQMNLVPEFAHDKTYVYKYEALLLGGLPQEGLARAGIKVSSKVLL
SAMTENTYLMKLMDPLLYEYAGTWPKDPFVPATKLTSALAAQLQIPIKFEYANGVVGKVF
APAGVSPTVMNLYRGILNILQLNLKKTQNIYELQEAGAQGVCRTHYVINEDPKTNHIIVT
KSKDLSHCQERIMKDVGLAYTESCPECTERVKSLIETATYNYIMKPADNGALIAEATVEE
VYQFSPFNEIHGAAMMEAKQTLAFVEIEKTPVVPIKADYMPRGSLQYEFATEILQTPIQL
MKISDATAQIVEVLTHLVANNKDMVHDDAPLKFVQLVQLLRLSTLDKFEAIWAQFKNKPV
YRRWLLDALPAVGTPVIIKFIKEKFLAGEFTTPEFIQTLVVALQMVTADLETIQMTYSLA
THEKFTTIPALREVVMLGYGSLIAKHCVAVPSCPAELLKPIHEITAEAISKNDIPEITLA
LKVMGNAGHPSSLKPIMKLLPGLRTAANALPIKVQVDAILALRNIAKKEPKLVQPIALQL
VLDRALHPEVRMVACIVLFEAKPSVALVSSLAGALRIEPNMHVASFAYSHIKSLTRITAP
DMASVAGAANVAIKLMNRKLDRLNYRYSRAFHMDYYHTPLMIGAAGSAYMINDAATILPR
AIVAKARTYLAGAAADVIEFGVRTGGIHEALLKSSAADESVDRITKIKRTLKALANWKAL
PTDRPLASAYVKVFGQEVAYVNFDKTIIEEAIPMVSGPKPRALLKEALKALQEGVAFQYA
KPLLAAEVRRILPTAVGVPMEFSLYTAAVAAASVNVQATITPPLPEKLESMTLDQLKRTD
VQFQAEARPSVALQTFAVMGVNTAFIQAAVMARGKIRTIAPGKVAARADILKGNYKVETL
PVELPEHIASASFETLAVVRNIEDHSAERSIPLVPELSLQNSQTSSAGDLSTEMSSAASV
RASAPFDRTLCYSCPYIQVKGCVEVHSYNAAFIRNSTLFYIIGQHSAHVAVARAEGPSVE
RLEFEVQVGPRAAERLVKQMNIIDDDTPEGQAFLLKLREILDTEAKNAPVSSESSSSRNS
RSSSSRSHSTSSSSSSRSSSSSSSSMSSSRMSKYLAHHSATKDTSSGSAAASFEQMQKQN
RFLGNDLPPVFAIIARAVRDDQKLLGYQLAAYFDKPTARVQLIASSIAENDNRKICADGA
LLSKHKVTGKFSWGAECKQYAVFAKAEAGVLGEFPAARLEVEWERLPIIVTTYAKKLCKH
ILKAAYDTGFRFERATNSEKEIELTAALPSQKSFDFIARIPEITMSKREIPLPVAVPINP
DGTFSIHTYEDFLSWIQKYIKDE
Download sequence
Identical sequences Q1MTC6
ENSDARP00000114558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]