SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115012 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115012
Domain Number 1 Region: 630-1034
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 7.06e-124
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000112
Further Details:      
 
Domain Number 2 Region: 29-294
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 9.81e-93
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000098
Further Details:      
 
Domain Number 3 Region: 294-628
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.27e-83
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000195
Further Details:      
 
Domain Number 4 Region: 1170-1337
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.75e-62
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115012   Gene: ENSDARG00000078429   Transcript: ENSDART00000136837
Sequence length 1363
Comment pep:known chromosome:Zv9:22:25256483:25263975:-1 gene:ENSDARG00000078429 transcript:ENSDART00000136837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKPPAMRAVVLALTVALVASQQMNLVPEFAHDKTYKYKYEALLLGGLPQEGLARAGIKVS
SKVLLSAVTENTYLMKLMDPLLYEYAGTWPKDSFVPATKLTSALAAQLQIPIKFEYANGV
VGKVFAPAGVSPTVMNLHRGILNILQLNLKKTQNIYELQEAGAQGVCRTHYVINEDPKTN
HIIVTKSKDLSHCQERIMKDVGLAYTERCAECTKRVKSLIETATYNYIMKPADNGALIAE
ATVEEVYQFSPFNEIHGAAMMEAKQTLAFVEIEKTPVVPFKADYMHRGSLQYEFATEILQ
TPIQLMKISDAPAQIVEVLKHLVANNKDMVHDDAPLKFVQLVQLLRVATLEKIEAIWSQF
KDKPVYRRWLLDALPAVGTPVIIKFIKEKFLAGEFTTPEFIQTLVIALQRVSADLETIQM
TASLAMHEKFSTVPALREVAMLGYGSLIARHCIAVPTCPAELLRPIHEIATEAVSKNDIP
EITLALKVMGNAGHPSSLKPIMKLLPGLRTAANALPVRVQVDAILALRNIAKKEPKLVQP
IALQLVLDRALHPEVRMVACIVLFEAEPSVALISSLAGALRTEPNMHVASFAYSHIKSLT
RITAPDMAYVAGAANVAIKLMNCKLDRLNYRYSRAFKMDYYYTPLMIGAAGSAYMINDAA
TILPRAVVAKARAYLAGAAADVVEFGVRTGGIHEALLKSPAADESVDRITKIKRTLRALT
NWKALPTDKPLASAYVKVFGQEVAYVNFDKTIIEEAIPMVTGPKPRALLKEALKALQEGI
AFQYAKPLLAAEVRRILPTAVGVPMEFSWYTAAVAAASVNVQATVTPALPEKLESMTYEQ
LKKTDVQFQAEARPSVALQTFAVMGVNTAFIQAAVMARGKIRTIAPGKVAARADILKGNY
KVEALPVDLPEHIASASFETLAVVRNIEDHSAERSVPFVPELSLQNSQASYAGDLSSEVS
PDASVRAPAPFDRTLCYAVPYIEIKGCVEVHSHNAAFIRNSTLFYIIGHHTARAAVSRAE
GPAVERLEFEVQVGPRAAERLLKQINIIDDDTPEGQAFLLKLREILDTEAKNAPVSSESS
SSSSRNSRSTSSSSTSTSSSGSSSSSSSSSSSMSSSRMSKTATIMEPFRKFHKDRYLAPH
SATKDTSSGSAAASFEQMQKKNRFLGNDIPPVFAIIARAVRADQKLLGYQLAAYFDKPTA
RVQLIASSIAENDNMKICADGALLSKHKVTAKFSWGAECKQYAVFAKAEAGVLGEYPAAR
LEVEWERLPKIASTYAKKVSKYILNAAYDTGFRFERATNSEKEIELTAALPSQKSLNVIA
RIPEITMSRRDIYLPVTVPINPDGTFTIDKDFLSWIHKYINED
Download sequence
Identical sequences F1Q7L0
ENSDARP00000115012 ENSDARP00000115012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]