SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000119635 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000119635
Domain Number 1 Region: 41-218
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.28e-25
Family Hypothetical protein cg14615-pa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000119635   Gene: ENSDARG00000075561   Transcript: ENSDART00000141631
Sequence length 218
Comment pep:putative chromosome:Zv9:13:33889780:33892397:-1 gene:ENSDARG00000075561 transcript:ENSDART00000141631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLNSDELKEAETSLYAHLPKAIKVYGFVFAMNRGKPNTLEILVDSWPAFTTIIVRPDP
NNGRAKDFMKKVTLYSTDEEVLRRMLTVENAIDWSTYFLIGGCDIRHLPMLKEISAARGV
RMKGLSLVHLMTLPEPGHLLQLITSDLESRITVLNESHADVVNKTWKFGGDDKGYRNVLH
LISHFPTCCITDENNQPVSWVLLYDYCAMGMLYTLPEH
Download sequence
Identical sequences B8A4D3
ENSDARP00000119635 7955.ENSDARP00000099451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]