SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122377 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122377
Domain Number 1 Region: 110-590
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.53e-132
Family Pyridoxal-dependent decarboxylase 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122377   Gene: ENSDARG00000093411   Transcript: ENSDART00000140425
Sequence length 591
Comment pep:novel chromosome:Zv9:9:3618418:3649709:-1 gene:ENSDARG00000093411 transcript:ENSDART00000140425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAPSSSSSGGVPDPNSTNLQPPSSIAHGCTRKLGMKICGFLQKNNNVDDKGRIVGLF
NDQQPRSILTRDNERDSRFRRTETDFSNLYARVNLILTDLLPAKNGEEYTMQFLLEVVEI
LTNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELCDQPESLEQILVDCRDTLKYGVRTG
HPRFFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWPNGE
GDGIFSPGGAISNMYSVMVARYKHYPEIKIKGMAAAPRLVLFTSEHSHYSIKKASAVLGF
GTENLILLRTDERGRVIPADLEAKVIDAKQKGFVPMFVNATAGSTVYGAFDPINEIADIC
EKYNMWLHVDGAWGGGLLMSRKHKHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGL
LQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKSKGTTGFEKHIDRC
LELSEYLYHKIKNREGYEMVFQGEPQHTNVCFWYIPPSLRLLPDGEEKRHRLHKVAPKIK
ALMMECGTTMVGYQPQGEKVNFFRMVVSNPAVTRSDIDFLIDEIERLGQDL
Download sequence
Identical sequences F6NX32
ENSDARP00000122377 ENSDARP00000122377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]