SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000127130 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000127130
Domain Number 1 Region: 325-419
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.64e-23
Family Ras-binding domain, RBD 0.000017
Further Details:      
 
Domain Number 2 Region: 118-219
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 1044-1146
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-23
Family PDZ domain 0.000032
Further Details:      
 
Domain Number 4 Region: 459-563
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.29e-22
Family FHA domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000127130   Gene: ENSDARG00000029472   Transcript: ENSDART00000152888
Sequence length 1927
Comment pep:novel chromosome:Zv9:20:43151895:43377812:-1 gene:ENSDARG00000029472 transcript:ENSDART00000152888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNTAESPDGELRSVQNRRLRERATLATETASENPHSGCYRFTFISGDRIRNPFEWITPNQ
RRKRRIVSPSDLASISLDLRMSGSREEERRKLADIINHWNANRLDLFEISQPTEDLEFHG
VMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGE
ERKLDLDEKPLVVQLNWNKDDREGRFVLKNENDIMPKRTLTNGPEKEKEGVIQNFKRTLS
KKEKKKEKKREKEAFSRIPDGDDHVLNREDGENSRLAAEVYKDMPETSFTRTISNPEVVM
KRRRQQKLEKRMQEFRSEDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDMADFAVAEAL
EKYGLEKENPRDYCIAQVIHANDKAVKETILDDTDCPLQILRDWTSDKEALVFQLKKRPP
DYAPRKGRKPDNRMGPQHGSIPPEKLPYLVELSPGRGSHYAYYYRHHEDGSDSRDKPKLY
RLQHSVTEVGSDRSEDGNIQLFGPGILPHHCDLMHADGLVTITPANMDAETFVDGQRIAD
TTVLRSGVTVQFGATHVFKFVDPSYDQSMSKRDPGPMMKGRHKSGSVPETTFDLHGDIHS
GSALPTSKSSGKLEMERSGNSSERGLVKPMIRGEQQDFSKHDGRSQDGPELTLPASIEFR
ENSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVMSSQYRPDISPSERTHKVIAIVN
KMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDKDLSRITLDAQDVLAHLVQMAFK
YLVHCLQSDLNNYMPAFLEDPDEQNPQRPKIEDVLHTLTGAMSLLRRCRVNAALTIQLFS
QLFHFVNMWLFNKLVTEADSGLCSHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQ
ATTLLTMDKYSMQDVQNINNTCFKLNSLQLNALLSNYHCAPDEPYIPPELIDHVVAVAEN
TADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGFQEFLEPLCQRGFCRLT
PHPRSPGTWTIYFEGANCDSHFSADTSELPMRKEPEIVTVTLKKHNGMGLSIVAAKGAGQ
DKLGIYIKSVVKGGAADMDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVA
KQGAIYHGLATLLNQPSPMMPRASDRGRGDKGKLRPKSEGFELYNNSVQNGSPESPQGTW
DTYPEPKKEDRLLKNRADHRSSPNVANQAQSPGGKPVYPGAPGKITSVSTGNLCPDEEPS
PPRPEAYPIPTQTYPREYFTFPASKSQDRMGPGQPWQNNEQEPLPPMDNHSNNSMVMQRV
ARSQEELCDMPGGYPGERLRQEDLMLLQQQQQREAEYQRGVGEHWNHQVSSSVESSTSSQ
EHLNFSSSSGSRTQGNHKSGPGRWKTPLAPHSGPVSQPSRSDLPPPPPPPPAHYDFEPQT
DLPLPPPPSATQQQQQAAADRKKREDQQRWYEKEKARLEEERERKRRDQERKLVQIRNPS
VSGPVMHNNQHGPVPPSPQMPPMTLPQSYLPPVQQPPPPQPARPDKLSSLPRQPPQDTVI
RDLLPQQQPRTIERRDLQYITISKEELSASDSLSPDPWKRDAREKLEKQQQLHIVDLLDK
EIQELQAKPERTAEDNDRLRKLMLEWQFQKRLQESKQNEEDEEEEDDEDVDTTLIMQRLE
AEKRARQTAVPAISVLDLLQDEERRRKQQLEEIRKREAEERAKQEEERRWREEERARREA
DEKRRQEEEYYTRLEAERRRQHEEAERKLPTPDETGLYRPPLPRDYQPPSPSSAPATNHT
TSAPPPPPQRNTSYLKTQVASPDTIYTAKFVSYNDEEEEEDEEDAGLTGFNSYTGNTTGL
VSGEVYKDPRDKWTKGSPDQENTIGGAPENLTFKERQRLFSQGKEVSNKVKASRKLMELE
NELNIKQ
Download sequence
Identical sequences U3JA65
ENSDARP00000127130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]