SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000127297 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000127297
Domain Number 1 Region: 22-75
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000942
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000127297   Gene: ENSDARG00000075016   Transcript: ENSDART00000153058
Sequence length 75
Comment pep:known chromosome:Zv9:20:53789479:53790457:1 gene:ENSDARG00000075016 transcript:ENSDART00000153058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDHKLRLLLFFSLIILSICRRFKPLSKHEYFYETESLNSLNKQVNGPKASCRVEILVPD
ASKYILRTTDCKLSE
Download sequence
Identical sequences ENSDARP00000127297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]