SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1a7aA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1a7aA
Domain Number 1 Region: 5-190,353-432
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1.17e-120
Family S-adenosylhomocystein hydrolase 0.000000000279
Further Details:      
 
Domain Number 2 Region: 191-352
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.8e-79
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1a7aA   PDB: 1a7a
Sequence length 432
Comment (A:)
Sequence
msdklpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvet
avlietlvtlgaevqwsscnifstqnhaaaaiakagipvyawkgetdeeylwcieqtlyf
kdgplnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainv
ndsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvi
iteidpinalqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnig
hfdveidvkwlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamghpsfvmsn
sftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgms
cdgpfkpdhyry
Download sequence
Identical sequences 1a7a_A 1a7a_B 1a7aA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]