SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1abeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1abeA
Domain Number 1 Region: 3-302
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.62e-71
Family L-arabinose binding protein-like 0.0000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1abeA   PDB: 1abe   SUPERFAMILY: 1abeA
Sequence length 306
Comment (A:)
Sequence
enlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakg
fvictpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqe
lykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndip
gafdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsel
skaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelek
kglggk
Download sequence
Identical sequences 1abeA 1abe_A 1abf_A 5abp_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]