SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1af3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1af3A
Domain Number 1 Region: 3-24,82-196
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 7.33e-73
Family Bcl-2 inhibitors of programmed cell death 0.000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1af3A   PDB: 1af3   SUPERFAMILY: 1af3A
Sequence length 196
Comment (A:)
Sequence
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapeeteperetpsaingnpswhla
dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaswmatylndhlep
wiqenggwdtfvdlyg
Download sequence
Identical sequences 1af3A 1af3_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]