SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1aogA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1aogA
Domain Number 1 Region: 4-102,230-351
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.09e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000226
Further Details:      
 
Domain Number 2 Region: 360-481
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.33e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000363
Further Details:      
 
Domain Number 3 Region: 4-63,103-228
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.64e-16
Family N-terminal domain of adrenodoxin reductase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1aogA   PDB: 1aog
Sequence length 485
Comment (A:)
Sequence
skifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkk
lmvtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegle
fflgwgslesknvvnvresadpasavkerletehillasgswphmpnipgiehcissnea
fylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrgfdhtlreeltkq
ltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaigrsprtkdlqlqnagv
miknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprktdhtrv
asavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiitnhsdg
tvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyyyvkge
kmekp
Download sequence
Identical sequences 1aog_A 1aog_B 1aogA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]