SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1auzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1auzA
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.93e-31
Family Anti-sigma factor antagonist SpoIIaa 0.000000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1auzA   PDB: 1auz   SUPERFAMILY: 1auzA
Sequence length 116
Comment (A:)
Sequence
slgidmnvkesvlcirltgeldhhtaetlkqkvtqslekddirhivlnledlsfmdssgl
gvilgrykqikqiggemvvcaispavkrlfdmsglfkiirfeqseqqalltlgvas
Download sequence
Identical sequences 1auz_A 1buz_A cath|current|1auzA00/1-116 cath|current|1buzA00/1-116 d1auza_ d1buza_ 1auzA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]