SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1b3rA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b3rA
Domain Number 1 Region: 4-189,352-431
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 3.81e-121
Family S-adenosylhomocystein hydrolase 0.000000000512
Further Details:      
 
Domain Number 2 Region: 190-351
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.1e-79
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b3rA   PDB: 1b3r
Sequence length 431
Comment (A:)
Sequence
adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
ngpfkpdhyry
Download sequence
Identical sequences 1b3rA 1b3r_A 1b3r_B 1b3r_C 1b3r_D 1k0u_A 1k0u_B 1k0u_C 1k0u_D 1k0u_E 1k0u_F 1k0u_G 1k0u_H 1ky4_A 1ky4_B 1ky4_C 1ky4_D 2h5l_A 2h5l_B 2h5l_C 2h5l_D 2h5l_E 2h5l_F 2h5l_G 2h5l_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]