SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1b5eA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b5eA
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Thymidylate synthase/dCMP hydroxymethylase 1e-65
Family Thymidylate synthase/dCMP hydroxymethylase 0.000000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b5eA   PDB: 1b5e   SUPERFAMILY: 1b5eA
Sequence length 246
Comment (A:)
Sequence
MISDSMTVEEIRLHLGLALKEKDFVVDKTGVKTIEIIGASFVADEPFIFGALNDEYIQRE
LEWYKSKSLFVKDIPGETPKIWQQVASSKGEINSNYGWAIWSEDNYAQYDMCLAELGQNP
DSRRGIMIYTRPSMQFDYNKDGMSDFMCTNTVQYLIRDKKINAVVNMRSNDVVFGFRNDY
AWQKYVLDKLVSDLNAGDSTRQYKAGSIIWNVGSLHVYSRHFYLVDHWWKTGETHISKKD
YVGKYA
Download sequence
Identical sequences A0A023ZVP3 A0A097J712 A0A097J7W3 P08773
gi|9632636|ref|NP_049659.1| D9IE75_BPT4 DCHM_BPT4 1b49_A 1b49_C 1b5d_A 1b5d_B 1b5e_A 1b5e_B 001900473|e1b5dA1|266.1.1.1|A:1-246 001900474|e1b5dB1|266.1.1.1|B:1-246 cath|current|1b49A00/1-241 cath|current|1b49C00/1-241 cath|current|1b5dA00/1-246 cath|current|1b5dB00/1-246 cath|current|1b5eA00/1-241 cath|current|1b5eB00/1-241 d1b5da_ d1b5db_ 1b5eA NP_049659.1.34590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]