SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1b5qA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1b5qA
Domain Number 1 Region: 4-314,415-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.7e-63
Family FAD-linked reductases, N-terminal domain 0.0000000000645
Further Details:      
 
Domain Number 2 Region: 295-404
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.79e-33
Family L-aminoacid/polyamine oxidase 0.00000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1b5qA   PDB: 1b5q
Sequence length 472
Comment (A:)
Sequence
atvgprvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganw
vegvnggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsve
emgeklsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtsl
qntvplatfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvrei
kyspggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytk
iflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqq
sdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlra
pvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyhvqgkyd
Download sequence
Identical sequences 1b5qA 1b37_A 1b37_B 1b37_C 1b5q_A 1b5q_B 1b5q_C 1h81_A 1h81_B 1h81_C 1h82_A 1h82_B 1h82_C 1h83_A 1h83_B 1h83_C 1h84_A 1h84_B 1h84_C 1h86_A 1h86_B 1h86_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]