SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1ba2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ba2A
Domain Number 1 Region: 3-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.8e-112
Family L-arabinose binding protein-like 0.0000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ba2A   PDB: 1ba2   SUPERFAMILY: 1ba2A
Sequence length 271
Comment (A:)
Sequence
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptrsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq
Download sequence
Identical sequences 1ba2A d1ba2a_ d1ba2b_ 1ba2_A 1ba2_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]