SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1bdbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bdbA
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.36e-63
Family Tyrosine-dependent oxidoreductases 0.0000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bdbA   PDB: 1bdb   SUPERFAMILY: 1bdbA
Sequence length 277
Comment (A:)
Sequence
MKLKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDHGDNVLGIVGDV
RSLEDQKQAASRCVARFGKIDTLIPNAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYI
HAVKACLPALVASRGNVIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELAPYVRVN
GVGSGGINSDLRGPSSLGMGSKAISTVPLADMLKSVLPIGRMPEVEEYTGAYVFFATRGD
AAPATGALLNYDGGLGVRGFFSGAGGNDLLEQLNIHP
Download sequence
Identical sequences H9A9X3 P47227
gi|91781197|ref|YP_556404.1| 1bdb_A 266265.Bxe_C1192 WP_011494296.1.38508 WP_011494296.1.39665 WP_011494296.1.45576 1bdbA cath|current|1bdbA00/1-276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]