SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1bgnA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bgnA
Domain Number 1 Region: 1-172,274-389
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.64e-58
Family FAD-linked reductases, N-terminal domain 0.00000000023
Further Details:      
 
Domain Number 2 Region: 175-275
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.85e-45
Family PHBH-like 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bgnA   PDB: 1bgn
Sequence length 394
Comment (A:)
Sequence
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareasgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerlkvferv
ypfgwlglladtppvsheliyanhprgfalcsqrsatrsryyvqvpltekvedwsderfw
telkarlpaevaeklvtgpsleksiapltsfvvepmqhgrlflagdaahivpptgakgln
laasdvstlyrlllkayregrgellerysaiclrriwkaerfswwmtsvlhrfpdtdafs
qriqqteleyylgseaglatiaenyvglpyeeie
Download sequence
Identical sequences 1bgnA 1bgn_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]