SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1bleA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bleA
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily PTS IIb component 4.32e-80
Family PTS IIb component 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bleA   PDB: 1ble   SUPERFAMILY: 1bleA
Sequence length 163
Comment (A:)
Sequence
MMNIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPSNVKASA
VSVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENHRRQITKS
VSVTEQDIKAFETLSDKGVKLELRQLPSDASEDFVQILRNVTK
Download sequence
Identical sequences A0A0C3JQ41 A0A125UKE6 A0A285K665 D4FZ99 G4ET68 L8ANI3 M4KTP6 P26380 U1ZAB3
gi|449095143|ref|YP_007427634.1| gi|428280148|ref|YP_005561883.1| 1ble_A cath|current|1bleA00/2-162 gi|560129663|ref|YP_008830804.1| 1bleA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]