SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1bzlA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1bzlA
Domain Number 1 Region: 1-103,231-352
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.96e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000226
Further Details:      
 
Domain Number 2 Region: 361-482
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.33e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000363
Further Details:      
 
Domain Number 3 Region: 2-64,104-229
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.52e-16
Family N-terminal domain of adrenodoxin reductase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1bzlA   PDB: 1bzl
Sequence length 486
Comment (A:)
Sequence
mskifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpk
klmvtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegl
efflgwgslesknvvnvresadpasavkerletehillasgswphmpnipgiehcissne
afylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrgfdhtlreeltk
qltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaigrsprtkdlqlqnag
vmiknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprktdhtr
vasavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiitnhsd
gtvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyyyvkg
ekmekp
Download sequence
Identical sequences 1bzl_A 1bzl_B 1bzlA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]