SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1camA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1camA
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.52e-142
Family Carbonic anhydrase 0.0000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1camA   PDB: 1cam   SUPERFAMILY: 1camA
Sequence length 259
Comment (A:)
Sequence
shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
nghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlv
hwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
gllpesldywtypgslatppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
dnwrpaqplknrqikasfk
Download sequence
Identical sequences cath|current|1calA00/3-261 cath|current|1camA00/3-261 1cal_A 1cam_A 1camA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]