SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1cboA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1cboA
Domain Number 1 Region: 314-445
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.18e-56
Family GMC oxidoreductases 0.000000113
Further Details:      
 
Domain Number 2 Region: 8-310,442-500
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.99e-41
Family FAD-linked reductases, N-terminal domain 0.00000000000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1cboA   PDB: 1cbo
Sequence length 504
Comment (A:)
Sequence
dnggyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrs
swfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmave
pkrsyfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkag
lgtvfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiq
tlhqvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtg
tlpnlnsevgagwgpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapm
pagletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkang
tiyrydlfgtqlkafaddfcynplggcvlgkatddygrvagyknlyvtdgslipgsvgvn
pfvtitalaernveriikqdvtas
Download sequence
Identical sequences 1cboA 1cbo_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]