SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1chuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1chuA
Domain Number 1 Region: 4-255,356-447
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.99e-75
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000000549
Further Details:      
 
Domain Number 2 Region: 430-521
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.98e-51
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 268-346
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.89e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1chuA   PDB: 1chu
Sequence length 540
Comment (A:)
Sequence
mntlpehscdvliigsgaaglslalrladqhqvivlskgpvtegstfyaqggiaavfdet
dsidshvedtliagagicdrhavefvasnarscvqwlidqgvlfdthiqpngeesyhltr
egghshrrilhaadatgrevettlvskalnhpnirvlertnavdlivsdkiglpgtrrvv
gawvwnrnketvetchakavvlatggaskvyqyttnpdissgdgiamawragcrvanlef
nqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivaraidhe
mkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahytcggvmvd
dhgrtdveglyaigevsytglhganrmasnslleclvygwsaaeditrrmpyahdistlp
pwdesrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyah
frvsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilspgnhyinr
Download sequence
Identical sequences 1chu_A 1chuA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]