SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1cl0A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1cl0A
Domain Number 1 Region: 3-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.61e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1cl0A   PDB: 1cl0
Sequence length 320
Comment (A:)
Sequence
gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
lpseeafkgrgvsacatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
tgcmaaldaeryldgladak
Download sequence
Identical sequences 1cl0A 1cl0_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]